missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MSC Partial ORF (NP_005089.1, 103 a.a. - 188 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009242-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16180246

  • 5030.41 SEK / 25µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a transcriptional repressor capable of binding an E-box element either as a homodimer or as a heterodimer with E2A in vitro. The encoded protein also forms heterodimers with E2A proteins in vivo. This protein is capable of inhibiting the transactivation capability of E47, an E2A protein, in mammalian cells. This gene is a downstream target of the B-cell receptor signal transduction pathway. [provided by RefSeq]

Sequence: ECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRP
Specifications

Specifications

NP_005089.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.2kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWPFVVSGRP
RUO
MSC
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9242
MSC (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ABF-1/ABF1/MYOR/bHLHa22
MSC
Yes
Videos
SDS
Documents
Certificates