missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MT1G Full-length ORF (NP_005941.1, 1 a.a. - 61 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00004495-P01.10ug
Additional Details : Weight : 0.00010kg
Description
Sequence: MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCASpecifications
| NP_005941.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.5kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC12386/MT1/MT1K | |
| MT1G | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 4495 | |
| MT1G (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MDPNCSCAAGVSCTCASSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCCA | |
| RUO | |
| MT1G | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |