missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human MYLK2 Partial ORF (NP_149109, 161 a.a. - 260 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00085366-Q01.10ug

Dettagli aggiuntivi : Weight : 0.00010kg

 vedi altre versioni di questo prodotto

Codice prodotto. 16131017

  • 3343.96 SEK / 10µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Descrizione

Descrizione

This gene encodes a myosin light chain kinase, a calcium/calmodulin dependent enzyme, that is exclusively expressed in adult skeletal muscle. [provided by RefSeq]

Sequence: KLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDC
Specifica

Specifica

NP_149109
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDC
RUO
MYLK2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
85366
MYLK2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KMLC/MLCK/MLCK2/skMLCK
MYLK2
Yes
Videos
SDS
Documenti
Certificati