missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30211546

Invitrogen™ Human NAA20 (aa 92-165) Control Fragment Recombinant Protein

Produktkod. 30211546
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30211546

Brand: Invitrogen™ RP107229

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66574 (PA5-66574. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln. Proteins with cell cycle functions are overrepresented in the pool of NatB substrates. Required for maintaining the structure and function of actomyosin fibers and for proper cellular migration.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P61599
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 51126
Namn Human NAA20 (aa 92-165) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 1500004D14Rik; 2900026I01Rik; AU041458; D2Ertd186e; dJ1002M8.1; Methionine N-acetyltransferase; N(alpha)-acetyltransferase 20, NatB catalytic subunit; NAA20; N-acetyltransferase 3 homolog; N-acetyltransferase 5; N-acetyltransferase 5 (ARD1 homolog, S. cerevisiae); N-acetyltransferase 5 (GCN5-related, putative); N-acetyltransferase 5, ARD1 subunit (arrest-defective 1, S. cerevisiae, homolog); N-alpha-acetyltransferase 20; N-alpha-acetyltransferase 20, NatB catalytic subunit; NAT3; NAT3P; NAT5; NAT5P; NatB catalytic subunit; natB complex subunit NAT5; N-terminal acetyltransferase B complex catalytic subunit NAA20; N-terminal acetyltransferase B complex catalytic subunit NAT5; N-terminal acetyltransferase complex ARD1 subunit
Vanligt namn NAA20
Gensymbol NAA20
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens LMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.