missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NDUFS3 Partial ORF (NP_004542, 155 a.a. - 264 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004722-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131765

  • 4055.00 SEK / 10µg
Estimated Shipment: 03-10-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency

Sequence: SAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
Specifications

Specifications

NP_004542
Liquid
4722
NDUFS3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NDUFS3
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
RUO
NDUFS3
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers