missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30200760

Invitrogen™ Human Nectin 1 (aa 37-165) Control Fragment Recombinant Protein

Produktkod. 30200760
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30200760 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30200760 Leverantör Invitrogen™ Leverantörsnummer RP90093

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82938 (PA5-82938. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain, and a cytoplasmic region. This protein acts as a receptor for glycoprotein D of herpes simplex viruses 1 and 2, and pseudorabies virus and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome as well as non-syndromic cleft lip with or without cleft palate. Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q15223
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5818
Namn Human Nectin 1 (aa 37-165) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias AI835281; AW549174; CD111; CLPED1; ectodermal dysplasia 4 (Margarita Island type); ED4; herpes simplex virus type 1 sensitivity; herpes virus entry mediator C; Herpesvirus entry mediator C; herpesvirus Ig-like receptor; HIgR; HV1S; Hvec; nectin 1; nectin cell adhesion molecule 1; nectin); Nectin1; nectin-1; nectin-1 alpha; nectin-1 delta; OFC7; poliovirus receptor-like 1; poliovirus receptor-related 1; poliovirus receptor-related 1 (herpesvirus entry mediator C; poliovirus receptor-related 1 (herpesvirus entry mediator C); poliovirus receptor-related 1 (herpesvirus entry mediator C; nectin); poliovirus receptor-related protein 1; PRR; PRR1; PVRL1; PVRR; PVRR1; SK-12
Vanligt namn Nectin 1
Gensymbol Nectin1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.