missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30200760

Invitrogen™ Human Nectin 1 (aa 37-165) Control Fragment Recombinant Protein

Produktkod. 30200760
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30200760

Brand: Invitrogen™ RP90093

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82938 (PA5-82938. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an adhesion protein that plays a role in the organization of adherens junctions and tight junctions in epithelial and endothelial cells. The protein is a calcium(2+)-independent cell-cell adhesion molecule that belongs to the immunoglobulin superfamily and has 3 extracellular immunoglobulin-like loops, a single transmembrane domain, and a cytoplasmic region. This protein acts as a receptor for glycoprotein D of herpes simplex viruses 1 and 2, and pseudorabies virus and mediates viral entry into epithelial and neuronal cells. Mutations in this gene cause cleft lip and palate/ectodermal dysplasia 1 syndrome as well as non-syndromic cleft lip with or without cleft palate. Alternative splicing results in multiple transcript variants encoding proteins with distinct C-termini.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q15223
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5818
Namn Human Nectin 1 (aa 37-165) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias AI835281; AW549174; CD111; CLPED1; ectodermal dysplasia 4 (Margarita Island type); ED4; herpes simplex virus type 1 sensitivity; herpes virus entry mediator C; Herpesvirus entry mediator C; herpesvirus Ig-like receptor; HIgR; HV1S; Hvec; nectin 1; nectin cell adhesion molecule 1; nectin); Nectin1; nectin-1; nectin-1 alpha; nectin-1 delta; OFC7; poliovirus receptor-like 1; poliovirus receptor-related 1; poliovirus receptor-related 1 (herpesvirus entry mediator C; poliovirus receptor-related 1 (herpesvirus entry mediator C); poliovirus receptor-related 1 (herpesvirus entry mediator C; nectin); poliovirus receptor-related protein 1; PRR; PRR1; PVRL1; PVRR; PVRR1; SK-12
Vanligt namn Nectin 1
Gensymbol Nectin1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens DSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDD
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.