missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30208728

Invitrogen™ Human Nectin 2 (aa 34-157) Control Fragment Recombinant Protein

Produktkod. 30208728
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30208728

Brand: Invitrogen™ RP90206

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82470 (PA5-82470. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q92692
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5819
Namn Human Nectin 2 (aa 34-157) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias AI325026; AI987993; CD112; herpes virus entry mediator B; Herpesvirus entry mediator B; herpesvirus entry protein B; hveB; mHveB; MPH; Murine herpes virus entry protein B; murine herpesvirus entry protein B; nectin cell adhesion molecule 2; Nectin2; Nectin-2; Poliovirus receptor homolog; poliovirus receptor related 2; poliovirus receptor-like 2; poliovirus receptor-related 2; poliovirus receptor-related 2 (herpesvirus entry mediator B); poliovirus receptor-related protein 2; poliovirus sensitivity; PRR2; Pvr; Pvrl2; PVRR2; Pvs
Vanligt namn Nectin 2
Gensymbol NECTIN2
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.