missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NHEJ1 Full-length ORF (NP_079058.1, 1 a.a. - 299 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | NP_079058.1 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 79840 |
| Molecular Weight (g/mol) | 59.7kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16124543
|
Abnova™
H00079840-P01.25UG |
25 ug |
6845.00 SEK
25µg |
Estimated Shipment: 28-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16114543
|
Abnova™
H00079840-P01.10UG |
10 ug |
4515.00 SEK
10µg |
Estimated Shipment: 28-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
Double-strand breaks in DNA result from genotoxic stresses and are among the most damaging of DNA lesions. This gene encodes a DNA repair factor essential for the nonhomologous end-joining pathway, which preferentially mediates repair of double-stranded breaks. Mutations in this gene cause different kinds of severe combined immunodeficiency disorders. [provided by RefSeq]
Sequence: MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFSSpecifications
| NP_079058.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 59.7kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS | |
| RUO | |
| NHEJ1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 79840 | |
| NHEJ1 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ12610/XLF | |
| NHEJ1 | |
| Recombinant | |
| wheat germ expression system |