missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NOVA1 Partial ORF (NP_002506, 408 a.a. - 507 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00004857-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16064475

  • 4865.00 SEK / 25µg


Estimated Shipment
09-02-2021
Add to basket

Description

Description

This gene encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq]

Sequence: SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
Specifications

Specifications

NP_002506
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
RUO
NOVA1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4857
NOVA1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nova-1
NOVA1
Yes
Videos
SDS
Documents