missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human NPY Full-length ORF (NP_000896.1, 1 a.a. - 97 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00004852-P02.25ug
Additional Details : Weight : 0.00010kg
Description
Sequence: MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMWSpecifications
NP_000896.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.3kDa | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
PYY4 | |
NPY | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
4852 | |
NPY (Human) Recombinant Protein (P02) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW | |
RUO | |
NPY | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Safety and Handling
Product Identifier
Signal Word
Hazard Category
Hazard Statement
Precautionary Statement
Supplemental information
- NPY (Human) Recombinant Protein (P02)
Signal Word
- Warning
Hazard Category
- Acute toxicity Category 4
- Serious eye damage/eye irritation Category 2
- Skin corrosion/irritation Category 2
Hazard Statement
- H302-Harmful if swallowed.
- H315-Causes skin irritation.
- H319-Causes serious eye irritation.
Precautionary Statement
- P102-Keep out of reach of children.
- P103-Read label before use.
- P233-Keep container tightly closed.
- P264-Wash thoroughly after handling.
- P270-Do not eat, drink or smoke when using this product.
- P280-Wear protective gloves/protective clothing/eye protection/face protection.
- P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
- P303+P361+P353-IF ON SKIN (or hair): Take off immediately all contaminated clothing. Rinse skin with water/ shower.
- P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
- P404-Store in a closed container.
- P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.
Supplemental information
- MIXTURE LIST-Contains : tris-HCl, reduced glutathione