missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human OTOA Partial ORF (NP_653273.3, 27 a.a. - 124 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4055.00 SEK - 6150.00 SEK

Specifications

Name OTOA (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 36.52kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16132037
View Documents Promotion Details
Abnova™
H00146183-Q01.25UG
25 ug
6150.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 11-08-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16122037
View Documents Promotion Details
Abnova™
H00146183-Q01.10UG
10 ug
4055.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 11-08-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

The protein encoded by this gene is specifically expressed in the inner ear, and is located at the interface between the apical surface of the inner ear sensory epithelia and their overlying acellular gels. It is prposed that this protein is involved in the attachment of the inner ear acellular gels to the apical surface of the underlying nonsensory cells. Mutations in this gene are associated with autosomal recessive deafness type 22 (DFNB22). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: NSRQDLHPLLQNMAEEIIDGSYLNALLDLIQFQSSHVWTDDLSHRVLAYLNSRNVAFTIPSLQAAVENHLEQRLHQPQKLLEDLRKTDAQQFRTAMKC
Specifications

Specifications

OTOA (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.52kDa
SDS
Product Certifications