missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human OVOL1 Full-length ORF (NP_004552.2, 1 a.a. - 267 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005017-P02.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16130988

  • 3343.96 SEK / 10µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a protein highly similar to Drosophila and mouse proteins. In Drosophila the ovo protein plays a critical role in Drosophila oogenesis and cuticle formation. In mice the ovo like protein is involved in hair formation and spermatogenesis. The function of the human gene product has not been determined. [provided by RefSeq]

Sequence: MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Specifications

Specifications

NP_004552.2
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
56.7kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HOVO1
OVOL1
Yes
wheat germ expression system
Liquid
5017
OVOL1 (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
RUO
OVOL1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates