missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30198102

Invitrogen™ Human p21 (aa 45-155) Control Fragment Recombinant Protein

Produktkod. 30198102
Change view
Click to view available options
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Kvantitet
30198102 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30198102 Supplier Invitrogen™ Supplier No. RP105703

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protein p21 is a tumor suppressor protein which is an inhibitor of Cyclin-dependent kinases (CDK) and is transcriptionally activated by p53. P21 is important in the response of cells to genotoxic stress and a major transcriptional target of p53 protein. The occurrence of p21 in the nucleus executes binding and inhibition activity of cyclin dependent kinases Cdk1 and Cdk2, and blocks the transition from G1 phase into S phase or from G2 phase into mitosis after DNA damage, which enables the repair of damaged DNA. In the cytoplasm, p21 protein has an anti-apoptotic effect. P21 is able to bind to and inhibit caspase 3, as well as the apoptotic kinases ASK1 and JNK. P21 exhibits a dual function in carcinogenesis, and acts as a tumor suppressor, prevents apoptosis, and acts as an oncogene.
TRUSTED_SUSTAINABILITY

Specifications

Tillträdesnummer P38936
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 1026
Namn Human p21 (aa 45-155) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias Activating Fragment 1; CAP20; cdk inhibitor CIP1; cdk inhibitor CIP1 (p21); CDKI; CDK-interacting protein 1; CDK-interaction protein 1; Cdkn1; CDKN1A; CDNK1A; CIP1; Cip1); cyclin dependent kinase inhibitor 1 A; cyclin-dependent kinase inhibitor 1; cyclin-dependent kinase inhibitor 1 A; Cyclin-dependent kinase inhibitor 1 A (p21; cyclin-dependent kinase inhibitor 1 A (P21); cyclin-dependent kinase inhibitor 1 A (p21, Cip1); cyclin-dependent kinase inhibitor 1 A variant 1; cyclin-dependent kinase inhibitor 1 A variant 2; DNA synthesis inhibitor; MDA6; MDA-6; melanoma differentiation associated protein 6; melanoma differentiation-associated protein; Melanoma differentiation-associated protein 6; OTTHUMP00000016298; p21; p21Cip1; p21Cip1/Waf1; p21WAF; PIC1; putative cyclin-dependent kinase inhibitor 1 A (p21/WAF1/CIP1); SDI1; SLC12A9; UV96; WAF1; Wild type p53 activated fragment 1 (WAF1); wild-type p53-activated fragment 1
Vanligt namn p21
Gensymbol CDKN1A
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens ARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKR
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.