missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30182443

Invitrogen™ Human P2X4 (aa 359-388) Control Fragment Recombinant Protein

Produktkod. 30182443
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30182443

Brand: Invitrogen™ RP97746

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83466 (PA5-83466. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with high calcium permeability. The main pharmacological distinction between the members of the purinoceptor family is the relative sensitivity to the antagonists suramin and PPADS. The product of this gene has the lowest sensitivity for these antagonists. Multiple alternatively spliced transcript variants have been identified for this gene although their full-length natures have not been determined.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q99571
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5025
Namn Human P2X4 (aa 359-388) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias AI504491; ATP receptor; ATP-gated cation channel protein; AW555605; D5Ertd444e; ionotropic purinergic receptor; P2 purinergic receptor subtype; P2RX4; P2X purinoceptor 4; P2X receptor, subunit 4; P2X4; P2X4 purinoceptor; P2x4 receptor; P2X4R; Purinergic receptor; purinergic receptor P2X 4; purinergic receptor P2X, ligand gated ion channel, 4; purinergic receptor P2X, ligand-gated ion channel 4; purinergic receptor P2X, ligand-gated ion channel, 4; purinergic receptor P2X4; purinergic receptor P2X4 isoform a; purinergic receptor P2X4 subunit variant 1; purinergic receptor P2X4 subunit variant 2; purinergic receptor P2x4 subunit variant e; purinoceptor P2X4; putative partial extracellular loop region
Vanligt namn P2X4
Gensymbol P2RX4
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens YCMKKRLYYREKKYKYVEDYEQGLASELDQ
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.