missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PAK1 Partial ORF (NP_002567, 191 a.a. - 280 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00005058-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
PAK proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling. PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. These proteins serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK1 regulates cell motility and morphology. Alternativelt spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASpecifications
| NP_002567 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.53kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| APRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA | |
| RUO | |
| PAK1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 5058 | |
| PAK1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC130000/MGC130001/PAKalpha | |
| PAK1 | |
| Recombinant | |
| wheat germ expression system |