missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PCSK6 Partial ORF (NP_002561, 860 a.a. - 969 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4630.00 SEK - 7020.00 SEK

Specifications

Accession Number	NP_002561
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	5046
Molecular Weight (g/mol)	37.84kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16128661 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00005046-Q01.25ug	25 ug	7020.00 SEK 25µg		Please sign in to purchase this item. Need a web account? Register with us today!

16118661 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00005046-Q01.10ug	10 ug	4630.00 SEK 10µg		Please sign in to purchase this item. Need a web account? Register with us today!

Description

The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Sequence: REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

Specifications

Accession Number	NP_002561
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	37.84kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	PACE4/SPC4
Gene Symbol	PCSK6
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	5046
Name	PCSK6 (Human) Recombinant Protein (Q01)
Immunogen	REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Regulatory Status	RUO
Common Name	PCSK6
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ Human PCSK6 Partial ORF (NP_002561, 860 a.a. - 969 a.a.) Recombinant Protein with GST-tag at N-terminal

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ Human PCSK6 Partial ORF (NP_002561, 860 a.a. - 969 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents