Läs mer
Abnova™ Human PCSK6 Partial ORF (NP_002561, 860 a.a. - 969 a.a.) Recombinant Protein with GST-tag at N-terminal
Beskrivning
The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]
Specifikationer
Specifikationer
| Tillträdesnummer | NP_002561 |
| För användning med (applikation) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulering | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 5046 |
| Molekylvikt (g/mol) | 37.84kDa |
| Namn | PCSK6 (Human) Recombinant Protein (Q01) |
| Kvalitetskontrolltestning | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Kvantitet | 25 ug |
| Immunogen | REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG |
| Förvaringskrav | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Visa mer |
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.