missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PELP1 Partial ORF (AAW80659.1, 337 a.a. - 410 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00027043-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135656

  • 3343.96 SEK / 10µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

PELP1 is a coactivator of estrogen receptor (see ESR1; MIM 133430)-mediated transcription and a corepressor of other nuclear hormone receptors and sequence-specific transcription factors (Choi et al., 2004 [PubMed 15456770]).[supplied by OMIM]

Sequence: LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR
Specifications

Specifications

AAW80659.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.77kDa
12.5% SDS-PAGE Stained with Coomassie Blue
LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR
RUO
PELP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
27043
PELP1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HMX3/MNAR/P160
PELP1
Yes
Videos
SDS
Documents
Certificates