missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human PER1 (aa 5-88) Control Fragment Recombinant Protein

Produktkod. 30201798
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30201798

Brand: Invitrogen™ RP107541

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Circadian rhythmicity is a basic property of phylogenetically diverse organisms which range from animals and plants, to fungi. Regulation of endogenous biological clocks is regulated at the genetic level by a protein-mediated, autoregulatory feed-back loop. In mammals, several genes that encode members of the basic helix-loop helix (bHLH) PAS (PER-ARNT-SIM) transcription factor family have been shown to play a significant role in regulating circadian oscillations. Transactivation of CLOCK-induced genes is mediated via an E box enhancer (CACGTG) found upstream of target genes. CLOCK-ARNT3 heterodimers bind to E box regulatory elements and stimulate gene transcription. CLOCK has been shown to transactivate the mammalian homolog of Drosophila per. PER, in concert with the product of the mammalian timeless gene (TIM), negatively regulates its own transcription by blocking the activity of the CLOCK-BMAL1 transactivation complex.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer O15534
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5187
Namn Human PER1 (aa 5-88) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias circadian clock protein PERIOD 1; Circadian pacemaker protein Rigui; hPER; hPER1; KIAA0482; mPer1; m-rigui; PER; PER1; per1 {ECO:0000312; period 1; period circadian clock 1; period circadian protein homolog 1; period homolog 1; Period, drosophila, homolog of; RGD:727863}; RIGUI; rPER1
Vanligt namn PER1
Gensymbol PER1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens LEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNGKDSALLETTE
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.