missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human PER2 (aa 490-585) Control Fragment Recombinant Protein

Produktkod. 30198616
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30198616

Brand: Invitrogen™ RP108899

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PER2, also known as Period circadian protein homolog 2, is a mainly nuclear protein that shows nucleocytoplasmic shuttling which is effected by interaction with other circadian core oscillator proteins and/or by phosphorylation. PER2 belongs to the basic helix-loop-helix family of transcription factors and contains a PAC (PAS-associated C-terminal) domain and two PAS (PER-ARNT-SIM) domains. PER2 is a component of the circadian core oscillator, which includes the CRY proteins, CLOCK or NPAS2, BMAL1 or BMAL2, CSNK1D and/or CSNK1E, TIMELESS, and the PER proteins. This protein is thus essential for generating circadian rhythms and is a negative element in the circadian transcriptional loop which influences clock function by interacting with other circadian regulatory proteins and transporting them to the nucleus. Expression of PER2 is fairly wide spread with strong expression in skeletal muscle and pancreas and slight expression in lung. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS).
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer O15055
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 8864
Namn Human PER2 (aa 490-585) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias circadian clock protein PERIOD 2; FASPS; FASPS1; hPER2; KIAA0347; mKIAA0347; mPer2; PER2; per2 {ECO:0000312; period 2; period circadian clock 2; period circadian protein 2; period circadian protein homolog 2; period circadian regulator 2; period homolog 2; RGD:61945}; rPER2
Vanligt namn PER2
Gensymbol Per2
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens SHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKSVTEMQTNPPAEKKAVPAMEKDSLGVSFPEELACKNQPTCSYQQIS
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.