missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30195880

Invitrogen™ Human PHD2 (aa 206-294) Control Fragment Recombinant Protein

Produktkod. 30195880
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30195880 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30195880 Leverantör Invitrogen™ Leverantörsnummer RP88765
 Begränsad artikel
Beräknad leverans: 03-11-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types.This gene encodes a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q9GZT9
Koncentration ≥5.0 mg/mL
För användning med (applikation) Neutralization, Control
Formulering PBS, 1M urea with no preservative; pH 7.4
Gen-ID (Entrez) 54583
Namn Human PHD2 (aa 206-294) Control Fragment
pH-intervall 7.4
Reningsmetod Purified
Kvantitet 100 μL
Förvaringskrav -20°C, Avoid Freeze/Thaw Cycles
Regulatorisk status RUO
Gene Alias AI503754; C1orf12; C1ORF12 antibody; ECYT3; egl nine homolog 1; egl nine-like protein 1; egl-9 family hypoxia inducible factor 1; egl-9 family hypoxia-inducible factor 1; EGLN 1 EGLN1; EGLN1; HALAH; HIF PH2; HIF prolyl hydroxylase 2; HIF-P4H 2; Hif-p4h-2; HIFPH2; HIF-PH2; HIF-prolyl hydroxylase 2; HPH2; HPH-2; Hypoxia-inducible factor prolyl hydroxylase 2; ORF13; P4H2; Phd2; PHD-2; PNAS-118; PNAS-137; Prolyl Hy; Prolyl hydroxylase domain-containing protein 2; SM20; SM-20; zinc finger MYND domain-containing protein 6; ZMYND6
Vanligt namn PHD2
Gensymbol Egln1
Produkttyp Protein
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens GICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKING
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.