missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human PMCA1 ATPase (aa 559-682) Control Fragment Recombinant Protein

Produktkod. 30204782
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30204782

Brand: Invitrogen™ RP89884

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The calcium pump of the plasma membrane, termed PMCA ATPase, pumps calcium from the cytosol to the extracellular space. This membrane-bound enzyme is related to a number of other ATPases including the SERCA ATPase and the sodium/potassium pump. There are four different genes encoding PMCA ATPase and studies have revealed 20 isoforms of the pump generated by alternate splicing of the primary gene products. mRNA distribution studies show that gene products 1 and 4 are transcribed in most tissues, however, products 2 and 3 are more tissue specific. Transcription of the splicing variants has also been found to be tissue specific. In the pancreas, where insulin secretion is calcium dependent, the beta cells only express the 4b isoform, however the alpha and gamma cells express both 4a and 4b isoforms. Studies have also shown that different splice variants have different affinities for calcium and calmodulin.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P20020
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 490
Namn Human PMCA1 ATPase (aa 559-682) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 2810442I22Rik; Atp2b1; ATPase plasma membrane Ca2+ transporting 1; ATPase, Ca++ transporting, plasma membrane 1; E130111D10Rik; plasma membrane Ca2+ pump (PMCA1b); plasma membrane calcium ATPase; Plasma membrane calcium ATPase isoform 1; plasma membrane calcium pump; Plasma membrane calcium pump isoform 1; Plasma membrane calcium-transporting ATPase 1; PMCA1; Pmca1a; Pmca1b; Pmca1c; PMCA1kb
Vanligt namn PMCA1 ATPase
Gensymbol ATP2B1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens DYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFSKGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEPEPEWDNENDIVTGLTCIAVVGI
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.