missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PREP Partial ORF (NP_002717.3, 611 a.a. - 710 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4515.00 SEK - 6845.00 SEK
Specifications
Accession Number | NP_002717.3 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 5550 |
Molecular Weight (g/mol) | 36.74kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16193255
|
Abnova™
H00005550-Q01.25UG |
25 ug |
6845.00 SEK
25µg |
Estimated Shipment: 02-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16183255
|
Abnova™
H00005550-Q01.10UG |
10 ug |
4515.00 SEK
10µg |
Estimated Shipment: 02-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
The protein encoded by this gene is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and degradation of peptide hormones and neuropeptides. [provided by RefSeq]
Sequence: LVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIPSpecifications
NP_002717.3 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MGC16060/PE/PEP | |
PREP | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
5550 | |
PREP (Human) Recombinant Protein (Q01) | |
LVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP | |
RUO | |
PREP | |
Wheat Germ (in vitro) | |
GST | |
Liquid |