missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRKACG Partial ORF (AAH39888.1, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005568-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16183295

  • 3343.96 SEK / 10µg

Estimated Shipment: 02-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for the alpha form of the PKA catalytic subunit. [provided by RefSeq]

Sequence: MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAID
Specifications

Specifications

AAH39888.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAID
RUO
PRKACG
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5568
PRKACG (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KAPG/PKACg
PRKACG
Yes
Videos
SDS
Documents
Certificates