missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PRND Full-length ORF (AAH43644.1, 27 a.a. - 176 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4515.00 SEK - 6845.00 SEK
Specifications
Accession Number | AAH43644.1 |
---|---|
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 23627 |
Molecular Weight (g/mol) | 42.24kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16177562
|
Abnova™
H00023627-P01.25UG |
25 ug |
6845.00 SEK
25µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16167562
|
Abnova™
H00023627-P01.10UG |
10 ug |
4515.00 SEK
10µg |
Estimated Shipment: 17-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders. [provided by RefSeq]
Sequence: RGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLMVKSpecifications
AAH43644.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
42.24kDa | |
Glutathione Sepharose 4 Fast Flow | |
RGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLMVK | |
RUO | |
PRND | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, Protein Array, ELISA, Western Blot | |
23627 | |
PRND (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DOPPEL/DPL/MGC41841/PrPLP/dJ1068H6.4 | |
PRND | |
Recombinant | |
wheat germ expression system |