missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PRPH Partial ORF (NP_006253, 374 a.a. - 470 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005630-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16123505

  • 5854.80 SEK / 25µg
Estimated Shipment: 26-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the peripherin found in photoreceptors. Mutations in this gene have been associated with susceptibility to amyotrophic lateral sclerosis. [provided by RefSeq]

Sequence: RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
Specifications

Specifications

NP_006253
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.41kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
RUO
PRPH
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5630
PRPH (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NEF4/PRPH1
PRPH
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers