missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PX19 Partial ORF (NP_037369, 3 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

3970.00 SEK - 6025.00 SEK

Specifications

Accession Number NP_037369
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Format Liquid
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 27166
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16145766
View Documents Promotion Details
Abnova™
H00027166-Q01.25UG
25 ug
6025.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 04-05-2023
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16135766
View Documents Promotion Details
Abnova™
H00027166-Q01.10UG
10 ug
3970.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 04-05-2023
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Sequence: KYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAERLFPANVAHSVYVLEDSIVDPQNQTMTTFTWNI
Specifications

Specifications

NP_037369
Liquid
27166
PX19 (Human) Recombinant Protein (Q01)
KYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAERLFPANVAHSVYVLEDSIVDPQNQTMTTFTWNI
RUO
PRELID1
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CGI-106/MGC87972/PRELI/PX19
PRELID1
Yes
wheat germ expression system
SDS
Product Certifications