missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human QSOX1 (aa 509-580) Control Fragment Recombinant Protein

Produktkod. 30203625
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30203625 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30203625 Leverantör Invitrogen™ Leverantörsnummer RP105036

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66006 (PA5-66006. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The QSOX1 gene, also known as Quiescin Q6, is a fusion of two ancient genes: thioredoxin and ERV1. Its expression is induced as fibroblasts begin to exit the proliferative cycle and enter quiescence, suggesting that this gene plays an important role in growth regulation. The QSOX1 protein oxidizes sulfhydryl groups to form disulfide bonds in proteins. QSOX1 expression is induced by hypoxia and appears to protect cells against oxidative stress-induced apoptosis.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer O00391
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5768
Namn Human QSOX1 (aa 509-580) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 1300003H02Rik; FAD-dependent sulfhydryl oxidase-2; hQSOX; mSOx; Q6; Qscn6; Qsox; QSO x 1; Quiescin Q6; quiescin Q6 sulfhydryl oxidase 1; quiescin sulfhydryl oxidase 1; RP11-502H18.3; rQSOX; rSOx; Skin sulfhydryl oxidase; Sox; So x 2; Sox-2; Sulfhydryl oxidase 1; testis tissue sperm-binding protein Li 62 n; thiol oxidase 1; UNQ2520/PRO6013
Vanligt namn QSOX1
Gensymbol Qsox1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens CSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDFPAAGSAARRDVQNVAAAPELAMGALELESRNSTLDP
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.