missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30203203

Invitrogen™ Human QSOX2 (aa 193-315) Control Fragment Recombinant Protein

Produktkod. 30203203
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30203203 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30203203 Leverantör Invitrogen™ Leverantörsnummer RP105740

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (%), Rat (%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

QSOX2 is a member of the sulfhydryl oxidase/quiescin-6 (Q6) family (QSOX1) that regulates the sensitization of neuroblastoma cells for IFN-gamma (IFNG)-induced cell death.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q6ZRP7
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 169714
Namn Human QSOX2 (aa 193-315) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias BC030934; neuroblastoma-derived sulfhydryl oxidase; QSCN6L1; QSOX2; quiescin Q6 sulfhydryl oxidase 2; quiescin Q6-like 1; quiescin Q6-like protein 1; quiescin sulfhydryl oxidase 2; SOXN; Sulfhydryl oxidase 2; thiol oxidase 2
Vanligt namn QSOX2
Gensymbol Qsox2
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens PIQPSDVLSLLDNRGSHYVAIVFESNSSYLGREVILDLIPYESIVVTRALDGDKAFLEKLGVSSVPSCYLIYPNGSHGLINVVKPLRAFFSSYLKSLPDVRKKSLPLPEKPHKEENSEIVVWR
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.