missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RAD54B Full-length ORF (AAH33710.2, 1 a.a. - 158 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00025788-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137732

  • 3343.96 SEK / 10µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. [provided by RefSeq]

Sequence: MLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
Specifications

Specifications

AAH33710.2
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
45kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FSBP/RDH54
RAD54B
Yes
wheat germ expression system
Liquid
25788
RAD54B (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
RUO
RAD54B
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates