missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RALGPS2 Partial ORF (NP_689876, 282 a.a. - 386 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00055103-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16117896

  • 5854.80 SEK / 25µg
Estimated Shipment: 18-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: LKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQA
Specifications

Specifications

NP_689876
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.29kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGPRHLLDDSVMEPHAPSRGQA
RUO
RALGPS2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
55103
RALGPS2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ10244/FLJ25604/KIAA0351/dJ595C2.1
RALGPS2
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers