missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RAPGEFL1 Partial ORF (NP_057423, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human RAPGEFL1 Partial ORF (NP_057423, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16116716
Price: 6845.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00051195-Q01.25ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16116716

6845.00 SEK / 25µg

Estimated Shipment: 22-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Descrizione

Sequence: MEGPEGLGRKQACLAMLLHFLDTYQGLLQEEEGAGHIIKDLYLLIMKDESLYQGLREDTLRLHQLVETVELKIPEENQPPSKQVKPLFRHFRRIDSCLQ

Specifica

Accession Number	NP_057423
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	36.63kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MEGPEGLGRKQACLAMLLHFLDTYQGLLQEEEGAGHIIKDLYLLIMKDESLYQGLREDTLRLHQLVETVELKIPEENQPPSKQVKPLFRHFRRIDSCLQ
Regulatory Status	RUO
Common Name	RAPGEFL1
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	51195
Name	RAPGEFL1 (Human) Recombinant Protein (Q01)
Quantity	25 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	Link-GEFII/MGC134798/MGC134799
Gene Symbol	RAPGEFL1
Recombinant	Recombinant
Expression System	wheat germ expression system

Suggerimenti di prodotto

Abnova™ Human RAPGEFL1 Partial ORF (NP_057423, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Descrizione

Specifica

Suggerimenti di prodotto

Documenti

Offerte speciali