missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RASSF3 Partial ORF (NP_835463.1, 29 a.a. - 112 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00283349-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16162687

  • 4055.00 SEK / 10µg
Estimated Shipment: 20-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The RAS oncogene (MIM 190020) is mutated in nearly one-third of all human cancers. Members of the RAS superfamily are plasma membrane GTP-binding proteins that modulate intracellular signal transduction pathways. A subfamily of RAS effectors, including RASSF3, share a RAS association (RA) domain.[supplied by OMIM]

Sequence: QGKPRSGQQDVEKEKETHSYLSKEEIKEKVHKYNLAVTDKLKMTLNSNGIYTGFIKVQMELCKPPQTSPNSGKLSPSSNGCMNT
Specifications

Specifications

NP_835463.1
Liquid
283349
RASSF3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC119194/MGC119195/MGC119197/RASSF5
RASSF3
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.98kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QGKPRSGQQDVEKEKETHSYLSKEEIKEKVHKYNLAVTDKLKMTLNSNGIYTGFIKVQMELCKPPQTSPNSGKLSPSSNGCMNT
RUO
RASSF3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers