missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human Rax Partial Orf (Np_038463.2, 104 A.A.-206 A.A.) Recombinant Protein With Gst Tag At N-Terminal.
Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | NP_038463.2 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 30062 |
| Name | RAX (Human) Recombinant Protein (Q01) |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16005485
|
Abnova™
H00030062-Q01.10UG |
10 ug |
4515.00 SEK
10µg |
Estimated Shipment: 22-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16015485
|
Abnova™
H00030062-Q01.25UG |
25 ug |
6845.00 SEK
25µg |
Estimated Shipment: 22-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Good Folding
- Excellent amino acids labeling
Immunogen Sequence: KEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQD
Specifications
| NP_038463.2 | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| RAX (Human) Recombinant Protein (Q01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MCOP3/RX | |
| RAX | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 30062 | |
| Glutathione Sepharose 4 Fast Flow | |
| KEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAKWRRQEKLEVSSMKLQD | |
| RUO | |
| RAX | |
| GST |
For Research Use Only