missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. Abnova™ Human RCP9 Partial ORF (NP_055293, 39 a.a. - 148 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human RCP9 Partial ORF (NP_055293, 39 a.a. - 148 a.a.) Recombinant Protein with GST-tag at N-terminal

Produktkod. 16118762
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
10 μg
25 μg
Förpackningsstorlek:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16118762 25 μg 25µg
16108762 10 μg 10µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16118762 Leverantör Abnova™ Leverantörsnummer H00027297Q01.25ug

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Se alternativa produkter

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Used for AP, Array, ELISA, WB-Re

This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Sequence: QQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA

Specifikationer

Tillträdesnummer NP_055293
För användning med (applikation) Antibody Production, ELISA, Protein Array, Western Blot
Formulering 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gen-ID (Entrez) 27297
Molekylvikt (g/mol) 37.84kDa
Namn RCP9 (Human) Recombinant Protein (Q01)
Kvalitetskontrolltestning 12.5% SDS-PAGE Stained with Coomassie Blue.
Kvantitet 25 μg
Immunogen QQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
Förvaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatorisk status RUO
Gene Alias CGRP-RCP/MGC111194/RCP/RCP9
Vanligt namn CRCP
Gensymbol CRCP
Art Wheat Germ (in vitro)
Rekombinant Recombinant
Protein Tag GST
Uttryckssystem wheat germ expression system
Form Liquid
Visa mer Visa mindre
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.