missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human REG1A Partial ORF (AAH05350, 67 a.a. - 166 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00005967-Q01.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16064675

  • 3234.00 SEK / 10µg


Estimated Shipment
09-02-2021
Add to basket

Description

Description

This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. Reg family members REG1B, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq]

Sequence: MNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN
Specifications

Specifications

AAH05350
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN
RUO
REG1A
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
5967
REG1A (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ICRF|MGC12447|P19|PSP|PSPS|PSPS1|PTP|REG
REG1A
Yes
Videos
SDS
Documents