missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RNF166 Partial ORF (NP_849163.1, 19 a.a. - 126 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00115992-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16121507

  • 6150.00 SEK / 25µg
Estimated Shipment: 07-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: GPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLCPLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKVQEQMAN
Specifications

Specifications

NP_849163.1
Liquid
115992
RNF166 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC14381/MGC2647
RNF166
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.62kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLCPLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRVHISSCLKVQEQMAN
RUO
RNF166
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers