missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ROD1 Partial ORF (NP_005147, 16 a.a. - 114 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009991-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161586

  • 6150.00 SEK / 25µg
Estimated Shipment: 05-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ROD1 is a functional homolog of nrd1, an S. pombe RNA-binding protein that suppresses the onset of differentiation.[supplied by OMIM]

Sequence: GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY
Specifications

Specifications

NP_005147
Liquid
9991
ROD1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp781I1117/PTBP3
ROD1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GSDELLSSGIINGPFTMNSSTPSTANGNDSKKFKRDRPPCSPSRVLHLRKIPCDVTEAEIISLGLPFGKVTNLLMLKGKSQAFLEMASEEAAVTMVNYY
RUO
ROD1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers