missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RPL26L1 Full-length ORF (NP_057177.1, 1 a.a. - 145 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051121-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16179652

  • 3343.96 SEK / 10µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a protein that shares high sequence similarity with ribosomal protein L26. It is not currently known whether the encoded protein is a functional ribosomal protein or whether it has evolved a function that is independent of the ribosome. Transcript variants utilizing alternative polyA signals exist. [provided by RefSeq]

Sequence: MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE
Specifications

Specifications

NP_057177.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
43.7kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ46904/RPL26P1
RPL26L1
Yes
wheat germ expression system
Liquid
51121
RPL26L1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEELIEKMQE
RUO
RPL26L1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates