Läs mer
Abnova™ Human RPTOR Partial ORF (NP_065812.1, 1226 a.a. - 1335 a.a.) Recombinant Protein with GST-tag at N-terminal
Beskrivning
This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-binding protein-1 and ribosomal protein S6 kinase. The protein positively regulates the downstream effector ribosomal protein S6 kinase, and negatively regulates the mTOR kinase. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Specifikationer
Specifikationer
Tillträdesnummer | NP_065812.1 |
För användning med (applikation) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulering | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 57521 |
Molekylvikt (g/mol) | 37.84kDa |
Namn | RPTOR (Human) Recombinant Protein (Q01) |
Kvalitetskontrolltestning | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Kvantitet | 25 μg |
Immunogen | HIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSVEKRVR |
Förvaringskrav | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Visa mer |
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.