missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30200510

Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein

Produktkod. 30200510
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30200510

Brand: Invitrogen™ RP91392

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64867 (PA5-64867, PA5-51512 (PA5-51512. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein remains unknown.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q9Y3I0
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 51493
Namn Human RTCB (aa 340-499) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 3'-phosphate/5'-hydroxy nucleic acid ligase; AI255213; AI463255; ankyrin repeat domain 54; C22orf28; C5H22orf28; D10Wsu52e; DJ149A16.6; FAAP; focal adhesion-associated protein; HAMAP-Rule:MF_03144}; HSPC117; hypothetical protein HSPC117; hypothetical protein LOC406376; hypothetical protein LOC525106; P55; RNA 2',3'-cyclic phosphate and 5'-OH ligase; RNA-splicing ligase RtcB homolog; RTCB; tRNA-splicing ligase RtcB homolog; tRNA-splicing ligase RtcB homolog {ECO:0000255; zgc:76871
Vanligt namn RTCB
Gensymbol Rtcb
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens PDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRP
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.