missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human RTN3 Partial ORF (NP_006045, 84 a.a. - 169 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010313-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The reticulons are a group of highly conserved genes with preferential expression in neuroendocrine tissues (see, e.g., RTN1; MIM 600865).[supplied by OMIM]
Sequence: SYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWSpecifications
NP_006045 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
35.2kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMW | |
RUO | |
RTN3 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
10313 | |
RTN3 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ASYIP/HAP/NSPL2/NSPLII/RTN3-A1 | |
RTN3 | |
Recombinant | |
wheat germ expression system |