missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RXRA Partial ORF (NP_002948.1, 27 a.a. - 94 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006256-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16064705

  • 3234.00 SEK / 10µg


Estimated Shipment
08-02-2021
Add to basket

Description

Description

Sequence: SMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQL
Specifications

Specifications

NP_002948.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.89kDa
12.5% SDS-PAGE Stained with Coomassie Blue
SMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQL
RUO
RXRA
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6256
RXRA (Human) Recombinant Protein
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ00280|FLJ00318|FLJ16020|FLJ16733|MGC102720|NR2B1
RXRA
Yes
Videos
SDS
Documents