missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human S100A10 (aa 1-67) Control Fragment Recombinant Protein

Produktkod. 30200476
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30200476 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30200476 Leverantör Invitrogen™ Leverantörsnummer RP102006

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82082 (PA5-82082. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The S-100 family of calcium-activated proteins interact with a range of target proteins to modulate biological signaling pathways. Numerous cancer cell lines overexpress the plasminogen receptor S-100A10 on the extracellular cell surface, where it forms a heterotetrameric complex with Annexin II, though this association is not required for plasma membrane localization or binding and activation of plasminogen. Additionally, S-100A10 acts as a cellular chaperone for hepatitis B (Hep B) virus polymerase. Hep B virus polymerase normally localizes to the cytoplasm only, though in the presence of S-100A10 a portion relocates to the nucleus, implying a role for S-100A10 and intracellular calcium in the process of viral replication.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P60903
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 6281
Namn Human S100A10 (aa 1-67) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 42 C; AA409961; AL024248; Annexin II; annexin II ligand; annexin II ligand, calpactin I, light polypeptide; annexin II tetramer (AIIt) p11 subunit; AN x 2 L; AN x 2 LG; Ca[1 ]; CAL12; Cal1l; calcium binding protein A11 (calgizzarin); calpactin I light chain; Calpactin-1 light chain; cellular ligand of annexin II; CLP11; GP11; MGC111133; MGC133268; Nerve growth factor-induced protein 42 C; OTTHUMP00000015270; P PRSS26; p10; p10 protein; P11; p11 subunit; Protein S100 A10; Protein S100-A10; S100 calcium binding protein A10; S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S100 calcium binding protein A10 (calgizzarin); S100 calcium binding protein A10 (calpactin); S100 calcium-binding protein A10; S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S-100 related protein, clone 42 C; S100a10
Vanligt namn S100A10
Gensymbol S100A10
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.