missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SCAND2 Partial ORF (NP_071333, 1 a.a. - 62 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4630.00 SEK - 7020.00 SEK

Specifications

Accession Number	NP_071333
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	54581
Molecular Weight (g/mol)	32.56kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16005545 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00054581-Q02.25ug	25 μg	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A

16095535 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00054581-Q02.10ug	10 μg	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A

Description

The SCAN domain is a highly conserved, leucine-rich motif of approximately 60 aa originally found within a subfamily of zinc finger proteins. This gene belongs to a family of genes that encode an isolated SCAN domain, but no zinc finger motif. Functional studies have established that the SCAN box is a protein interaction domain that mediates both hetero- and homoprotein associations, and maybe involved in regulation of transcriptional activity. Multiple transcript variants which encode the same isoform but differ only in their 3' UTRs, and another variant which encodes a distinct isoform have been described for this gene.

Sequence: MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREA

Specifications

Accession Number	NP_071333
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	32.56kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	SCAND2
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	54581
Name	SCAND2 (Human) Recombinant Protein (Q02)
Immunogen	MAVAVDQQIQTPSVQDLQIVKLEEDSHWEQEISLQGNYPGPETSCQSFWHFRYQEASRPREA
Regulatory Status	RUO
Gene Symbol	SCAND2
Recombinant	Recombinant
Expression System	wheat germ expression system

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ Human SCAND2 Partial ORF (NP_071333, 1 a.a. - 62 a.a.) Recombinant Protein with GST-tag at N-terminal

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ Human SCAND2 Partial ORF (NP_071333, 1 a.a. - 62 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents