missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human SEC22C (aa 95-173) Control Fragment Recombinant Protein

Produktkod. 30210363
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30210363 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30210363 Leverantör Invitrogen™ Leverantörsnummer RP106646

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65957 (PA5-65957. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in vesicle transport between the ER and the Golgi complex.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q9BRL7
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 9117
Namn Human SEC22C (aa 95-173) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 4932412K21; 5930407I15Rik; C530046H07; SEC22 homolog C, vesicle trafficking protein; SEC22 vesicle trafficking protein homolog C; SEC22 vesicle trafficking protein homolog C (S. cerevisiae); SEC22 vesicle trafficking protein-like 3; SEC22 vesicle trafficking protein-like C; SEC22 vesicle trafficking protein-like protein C; SEC22 vesicle-trafficking protein homolog C; SEC22 vesicle-trafficking protein-like 3; SEC22C; Sec22l3; secretion deficient 22 C; Unknown (protein for MGC:134135); UNQ459/PRO784; Vesicle-trafficking protein SEC22c
Vanligt namn SEC22C
Gensymbol SEC22C
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens TASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHL
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.