Learn More
Abnova™ Human SENP5 Partial ORF (NP_689912, 2 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00205564-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates (Di Bacco et al., 2006 [PubMed 16738315]).[supplied by OMIM]
Sequence: KKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTWIKDEHLCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSKSpecifications
NP_689912 | |
Liquid | |
205564 | |
SENP5 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DKFZp564O1016/FLJ42398/MGC27076 | |
SENP5 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.62kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
KKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTWIKDEHLCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSK | |
RUO | |
SENP5 | |
Wheat Germ (in vitro) | |
GST |