missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30198581

Invitrogen™ Human SERPINB9 (aa 166-230) Control Fragment Recombinant Protein

Produktkod. 30198581
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30198581

Brand: Invitrogen™ RP94947

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83122 (PA5-83122. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PI9 belongs to the large superfamily of serine proteinase inhibitors (serpins), which bind to and inactivate serine proteinases. These interactions are involved in many cellular processes, including coagulation, fibrinolysis, complement fixation, matrix remodeling, and apoptosis (Sprecher et al., 1995 [PubMed 8530382]).
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P50453
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5272
Namn Human SERPINB9 (aa 166-230) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias BB283241; CAP3; CAP-3; Cytoplasmic antiproteinase 3; ovalbumin; peptidase inhibitor 9; PI9; PI-9; protease inhibitor 9 (ovalbumin type); serine (or cysteine) peptidase inhibitor, clade B, member 9; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 9; serine (or cysteine) proteinase inhibitor, clade B, member 9; serine protease inhibitor 6; serpin B9; serpin family B member 9; serpin peptidase inhibitor, clade B (ovalbumin), member 9; serpin peptidase inhibitor, clade B, member 9; SERPINB9; Spi6; testicular tissue protein Li 180
Vanligt namn SERPINB9
Gensymbol SERPINB9
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens YFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLV
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.