missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SFXN3 Partial ORF (AAH00124.2, 125 a.a. - 224 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00081855-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16065695

  • 3234.00 SEK / 10µg


Estimated Shipment
11-02-2021
Add to basket

Description

Description

Sequence: WVNQSFNAIVNYSNRSGDTPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPVADEAGQRLGYSVTA
Specifications

Specifications

AAH00124.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
WVNQSFNAIVNYSNRSGDTPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAANCINIPLMRQRELQVGIPVADEAGQRLGYSVTA
RUO
SFXN3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
81855
SFXN3 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BA108L7.2|SFX3
SFXN3
Yes
Videos
SDS
Documents