missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SH3GL2 Partial ORF (NP_003017, 64 a.a. - 124 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006456-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16185215

  • 5030.41 SEK / 25µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL
Specifications

Specifications

NP_003017
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.45kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL
RUO
SH3GL2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6456
SH3GL2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CNSA2/EEN-B1/FLJ20276/FLJ25015/SH3D2A/SH3P4
SH3GL2
Yes
Videos
SDS
Documents
Certificates