missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human Slc1A5 Full-Length Orf (No Protein_Acc, 1 A.A.-493 A.A.) Recombinant Protein With Gst Tag At N-Terminal.

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

Brand:  Abnova™ H00006510-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16115355

  • 4055.00 SEK / 10µg
Estimated Shipment: 11-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Good Folding
  • Excellent amino acids labeling

Immunogen Sequence: MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVVCSLIGGAASLDPGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPS

Specifications

Specifications

no protein_acc
Liquid
6510
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AAAT/ASCT2/ATBO/FLJ31068/M7V1/M7VS1/R16/RDRC
SLC1A5
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
SLC1A5 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue
MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVVCSLIGGAASLDPGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIVEMEDVGLLFARLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGTSSSSATLPLMMKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVTATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM
RUO
SLC1A5
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers

For Research Use Only